BBLLAACCKKYYEELLLLOOWWMMAAGGEENNTTAACCYYAANNVITEKVT-E Series 4, 8, and 16 Channel DigitalVideo Recorders• 4, 8, or 16 Video Inputs• Remote Viewing ove
10SYSTEM CONFIGURE (4CH, 8CH, 16CH)SYSTEM CONFIGURE (4CH, 8CH, 16CH)1. Front panel description.Remote Controller Sensor : Communicate with the remote
11SYSTEM CONFIGURE (4CH)SYSTEM CONFIGURE (4CH)2. Rear panel description.2 4 75 1298 10 131 3 6 11Video In : BNC Port for Connection of DVR & Camer
12SYSTEM CONFIGURE (8CH, 16CH)SYSTEM CONFIGURE (8CH, 16CH)2. Rear panel description.1234765Video IN : BNC Video Input Port (8/16).Monitor out : BNC Ma
13SYSTEM CONFIGURE SYSTEM CONFIGURE ––Remote ControllerRemote Controller3. Remote Controller description.POWERSystem ON/OFFMENU : Open System Setup Me
14CONNECT & POWER ONCONNECT & POWER ON• Connect up to 4/8/16 CAMERA INPUTS as necessary. • Connect one or more monitors to the DVR using the C
15LIVE DISPLAYLIVE DISPLAYSPLIT SCREEN8 different display modes are supported by the 16 channel DVR.By repeatedly pressing the SCR MODE button, the op
16LIVE display edit modeFor each multi screen view mode, the operator can decide which channels to view and in what position.Use the SCR MODE button t
17Digital ZoomWhen viewing a channel in full screen, the operator can zoom in to a particular area by up to 8 times.To use digital zoom, select the re
18Press the SEQ button. Each channel is shown in full screen for a set period of time (default 3 sec) before switching to the next channel.To stop the
19LIVE DISPLAYLIVE DISPLAYPTZ Camera ControlSpeed domes and other telemetry devices connected to the DVR, can be fully controlled.In live display mode
2Buzzer ---------------------------------------------------------- 35Motion Sensor ---------------------------------------------------- 31Sequence
20Press the MENU button to bring up the menu login screen.Only operators with ADMIN rights can configure the DVR. Enter the default password of ‘1234’
21DISPLAY: To setup the various display options, highlight DISPLAY and press ENTERDISPLAY - OSDSTATUS BAR : Turns the status bar at the bottom of the
22DISPLAY : MONITORSEQUENCE DWELL : The time that each screen is displayed in a sequence operation.SPOT-OUT DWELL : The time that each screen is displ
23DISPLAY : SEQUENCEWhen the SEQ button is pressed, the default sequence will cycle through all 16 channels, one by one.Sequence setup allows the oper
24GENERALGENERALDISPLAY : SEQUENCE continuedDouble click on the SEQUENCE TITLE tab.Virtual Keyboard will be displayed. Then click the any name and cli
25DISPLAY : SEQUENCE continuedThe square on the top left of the display represents the first sequence screen that will be displayed. To edit the scree
26DISPLAY : SEQUENCE continuedWhen all the channels have been completed, press ENTER to save the sequence screen and begin creating the next one.Up to
27DISPLAY : SEQUENCE continuedThe new sequence is now saved and can be started by pressing the SEQUENCE button when in live view.GENERALGENERALWhen yo
28GENERALGENERALCAMERAClick the CAMERA menu. To setup the various camera options, highlight CAMERA and press the ENTER button.DISPLAY : SPOT-OUT conti
29CAMERA : CAMERA TITLE COVERT: When set to ON, the camera image is not displayed in live display but continues to be recorded.TITLE: For each camera,
3BACKUP ----------------------------------------------------------------- 56DISK MANAGEMENT ---------------------------------------------------- 47RE
30CAMERA : COLOR SETUP continuedCAMERA : PTZ SETUPThe selected channel is displayed in full screen.BRIGHTNESS, CONTRAST, TINT and COLOUR can be change
31CAMERA : PTZ SETUP continuedPTZ properties can also be adjusted for each channel by selecting the icon and pressing ENTER.Note that some s
32AREA SETUP : Choosing this option allows the operator to define which areas of the image are monitored for motion detection.Light blue grid square
33CAMERA : MOTION SENSOR continuedTo select or deselect specific areas, press ENTER to bring up the green cursor square in the top left of the display
34Once the detection area has been defined, press RETURN and choose SAVE & EXIT to save the area and return to the motion setup menu.Please note :
35SOUND : AUDIOLIVE AUDIO : When set to ON, the selected audio channel can be monitored on the AUDIO OUTPUT.AUDIO MONITORING CHANNEL: Specify which on
36GENERALGENERALSYSTEMTo setup the various system options, highlight SYSTEM and press ENTER.DATE / TIMEDATE FORMAT : Determines how the date is displa
37SYSTEM : NETWORKDHCP : When enabled, the DVR will obtain an IP address automatically if connected to a DHCP serveror router.DDNS : When enabled, the
38SYSTEM : MAILSERVER : The SMTP outbound email server that should be used to send email notifications.PORT : The outbound email port number.SECURITY
39USER ID : Edit the user ID using the virtual keyboard.PASSWORD : Change the password using the virtual keyboard.NOTE: To delete the existing passwor
4Log Viewer ------------------------------------------------------- 76Still Shot -------------------------------------------------------- 75Arc
40To add users, highlight ADD and press ENTER button. The new user details can be added using the steps outlined above.More Information about user man
41SYSTEM : SYSTEM MANAGEMENTS/W version : Shows the firmware version of the DVR.H/W version : Shows the hardware version of the DVR.VIDEO SIGNAL TYPE:
42EVENT / SENSORTo setup the various event handling options, highlight EVENT/SENSOR and press ENTER.EVENT / SENSOR : HDD EVENTThe DVR can monitor the
43EVENT / SENSOR : ALARM INPUTDetermines the behavior of each of the 4 alarm inputs.OPERATION : Alarm inputs can be enabled or disabled.TYPE : Alarm i
44EVENT / SENSOR : ALARM OUTPUT continuedMODE : Can be either TRANSPARENT (the output is active only when the trigger criteria is present) orLATCHED (
45EVENT / SENSOR : BUZZER OUTHDD EVENT : Determines whether a hard drive event sounds the buzzer.Action settingsALARM : Determines whether alarm input
46EVENT / SENSOR : EMAIL NOTIFICATIONDetermines the behavior and actions that will send an email to a remote user.Behavior settingsNOTIFICATION : Emai
47DISK MANAGEMENTSYSTEMSYSTEMTo manage the internal hard drives, highlight DISK MANAGE and press ENTER.RECORD TIME LIMIT : In certain circumstances, i
48RECORDTo setup the recording behavior of the DVR, highlight RECORD MENU and press ENTER button.RECORDING OPERATIONSCHEDULE MODE : Either DAILY (one
49TIMER / MOTION SETUPThis setup screen allows the operator to configure scheduled and motion detection recording. There are 2 sections:PARAMETER : Re
5BEFORE INSTALLATIONBEFORE INSTALLATION● Installation should be carried out only by qualified personnel and in accordance with any electricalregulatio
50Press ENTER to display the green cursor. The green cursor shown represents one hour (in this case between 00:00 and 01:00).The table below the time
51PARAMETER continuedPress ENTER. Recording settings for the selected time period are displayed.During playback, when a particular channel is selected
52SCHEDULETo change SCHEDULE settings, highlight MOTION RECORD SCHEDULE and press ENTER.The schedule box is highlighted in yellow.Press ENTER to displ
53SCHEDULE continuedUse the CURSOR KEYS to stretch the white cursor across and down to select all channels between your desired times.RECORDRECORDDrag
54SCHEDULE continuedThe selected area now displays the symbol for motion recording (marked blue block).Repeat the above procedure to set different rec
55RECORDRECORDALARM RECORD SETUPThis setup screen allows the operator to configure alarm input activated recording.PARAMETER : Recording settings for
56BACKUPTo archive recorded footage to USB memory stick or CD, press the F2 button.To protect unauthorized viewing and distribution of footage, only t
57BACKUP continuedSELECT DEVICE: Choose between CDR or USB.FROM / TO: Start and end time to backup.MODE: ‘Writing or ‘Erase and Write’A/V CHANNEL: Vid
58BACKUP continuedOnce all the desired archive options have been selected, highlight the START button and press ENTER. The DVR displays a list showing
59SEARCHSEARCHSEARCHTo search for a particular section of recorded footage, press the SEARCH button.To protect unauthorized viewing of footage, only A
6MAIN FEATURESMAIN FEATURESMOUSE CONTROLDesigned to be controlled by mouse and easy to use. ENHANCED GRAPHICAL USER INTERFACE [GUI]The DVR menu struct
60SEARCHSEARCHSEARCH continuedPress RETURN to change the calendar and use the CURSOR KEYS to move the square to the required day.MEMORY : To change th
61SEARCH continuedThe default playback mode is 4/8/16 screen display.By pressing DISPLAY or using the CHANNEL SELECTION buttons, it is possible to dis
62SEARCHSEARCHEVENT SEARCH The DVR event log stores events such as motion and alarm activated recording, video loss etc.To search for an event and pla
63Highlight START and press ENTER to display the event log for the criteria selected.To playback footage for a particular event, select the event from
64The DVR is supplied with software to allow remote connections either on a direct LAN connectionor over the Internet.The remote client allows full li
65REMOTE CLIENT SETUPREMOTE CLIENT SETUPThe DVR remote client software is installed.A final install screen is displayed confirming that installation i
66Client Software OrganizationREMOTE CLIENT SETUPREMOTE CLIENT SETUP①②③④⑤①②③④⑤⑥⑦⑧⑨⑩CHANNEL SELECTION buttonsSTATUS buttonALARM buttonTALKBACK buttonAU
67EXPLAINATION OF FUNCTION KEYSREMOTE CLIENT SETUPREMOTE CLIENT SETUP① CAMERA SELECTION Button : Indicate Connected Camera No. & Select camera No
68CREATE A CONNECT GROUPREMOTE CLIENT SETUPREMOTE CLIENT SETUPThe DVR remote client software can be configured with any number of connection groups. E
69DETAIL SETUPREMOTE CLIENT SETUPREMOTE CLIENT SETUPDetails for up to 4 DVRs can be added to the ‘OFFICE’group. Click ‘OFFICE’ to highlight it and the
7MAIN FEATURESMAIN FEATURESPTZ CONTROLFull telemetry control is available from the front panel or remote connection and a wide number of speedDome pro
70DETAIL SETUP continuedREMOTE CLIENT SETUPREMOTE CLIENT SETUPTo complete the details for the selected DVR:-Tick the event occurrences that the DVR wi
71ADDITIONAL CONFIGURATIONREMOTE CLIENT SETUPREMOTE CLIENT SETUPClick the ‘Configuration’ tab to setup various remote client program options.Video OSD
72REMOTE SEARCHClick the SEARCH button to playback. REMOTE CLIENT SETUPREMOTE CLIENT SETUP①②③④⑤⑥⑦①②③④⑤⑥LIVE buttonDVR SETUP buttonSETUP buttonDIVISION
73EXPLAINATION OF FUNCTION KEYSREMOTE CLIENT SETUPREMOTE CLIENT SETUP① LIVE Button : Return to the Live mode. SETUP Button : Entering the client softw
74REMOTE CLIENT SETUPREMOTE CLIENT SETUPQUICK SEARCHClick the SEARCH button in live display mode to switch to search mode.The TIMELINE at the bottom o
75ARCHIVING REMOTE CLIENT SETUPREMOTE CLIENT SETUPSTILL SHOTPre-recorded footage on a DVR can be archived to the local PC hard disk.Click the ARCHIVE
76LOG VIEWERREMOTE CLIENT SETUPREMOTE CLIENT SETUPBACKUP PLAYERTo view archives backed up from a DVR, double click the player file.Click t
77PRINTREMOTE CLIENT SETUPREMOTE CLIENT SETUPEVENT VIEWERDuring playback, a still image can be printed on the local PC printer by clicking the PRINT b
78REMOTE RECORDING SETUPOnly the ADMIN user can configure a DVR remotely. With the exception of network settings and certain display options, any of t
79REMOTE RECORDING SETUP continuedREMOTE CLIENT SETUPREMOTE CLIENT SETUPCAMERA• Convert / Title Convert the camera and change the camera name.(Covert
8SYSTEM ORGANIZATIONSYSTEM ORGANIZATIONNETWORKCameraAlarm Sensor Alarm out, Relay OutVCRVGA MonitorAV MonitorRemote Client PC Image PrinterVideo InVid
80REMOTE RECORDING SETUP continuedREMOTE CLIENT SETUPREMOTE CLIENT SETUPEVENT / SENSOR• Alarm InputSetup the Alarm Connection & Type of each chann
81REMOTE RECORDING SETUP continuedREMOTE CLIENT SETUPREMOTE CLIENT SETUPSYSTEM•System InfoCheck the DVR System information. •SMTPType the SMTP server
28492 CONSTELLATION ROAD VALENCIA, CA 91355WWW.VITEKCCTV.COM | 888-VITEK-70
Technical Addendum: VT-E Series DVRs Following: an update to the manual page 17: Digital zoom The zoom feature will ONLY work with the 8 or 16 cha
9SYSTEM CONTENTSSYSTEM CONTENTS① Basic ContentsRemote ControllerUser’s ManualRemote Client Program Install CDAAA Battery X 2Power Cable
Commentaires sur ces manuels